« Zurück
Startseite /
HTR7 Antibody - N-terminal region

HTR7 Antibody - N-terminal region

ArtNr	AVARP13048_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Western Blot Primary Antibodies Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI
Citations	Heidmann, D.E.A., et al., (1997) J. Neurochem. 68:1372-1381.
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	5-HT7
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Receptors, Root Catalog/Research Areas/GPCR, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	49kDa
Species Tested	Human
Gene symbol	HTR7
Gene Fullname	5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
Protein size	445
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GPRASP2; GPRASP1; RHOBTB3; CUL3;
Description of target	This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by g proteins that stimulate adenylate cyclase.
Nucleotide accession_num	NM_000872
Protein accession_num	NP_000863
Protein name	5-hydroxytryptamine receptor 7
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human HTR7
Homology	Dog: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rat: 92%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern