Vergleich

Anti-Kv1.2 Potassium Channel Subunit Antibody

ArtNr 75-314
Hersteller Antibodies Incorporated
Menge 100 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC, ICC
Clon L76/36
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG2a
Konjugat/Tag Unconjugated
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Primary Antibody
Manufacturer - Targets
Kv1.2 potassium channel subunit
Country of Origin
United States
Shipping Temperature
Shipped on ice packs
Storage Conditions
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight
80 kDa
Manufacturer - Research Area
Ion Channels and Modulators, K+ Channels
Expiration
24 months from date of receipt
Immunogen
Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
Immunogen Species
Human
Description
Our Anti-Kv1.2 potassium channel subunit mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L76/36. It is KO validated, detects human, mouse, and rat Kv1.2 potassium channel subunit, and is purified by Protein A chromatography. It is great for use in IHC, WB.
Target Description
Potassium voltage-gated channel subfamily A member 2 (also known as Potassium Voltage-Gated Channel A Member 2 , Shaker-Related Subfamily, Member 2 or Voltage-Gated Potassium Channel Protein Kv1.2, or KCNA2) is a member of the Kv family of potassium channels. Kv1.2 contains six membrane spanning domains and belongs to the delayer rectifier class of potassium channels. Kv2.1 mediates the voltage dependent potassium ion permeability of excitable membranes. Kv1.2 binds PDZ domains of DLG1, DLG2 and DLG4. Kv1.2 is found primarily in the brain (at the axon initial segment, axon preterminals and juxtaparanode domains), central nervous system, but also in the cardiovascular system. Kv2.1 has been implicated in epileptic encephalopathy, early infantile, and episodic ataxia, type 1.
Clonality
Monoclonal
Manufacturer - Specificity
No cross-reactivity reported
Concentration
1 mg/mL
Form
Purified by Protein A chromatography
Buffer
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application
WB Brain
Usage Statement
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement
We produce our Kv1.2 potassium channel subunit mouse monoclonal primary antibody from hybridoma clone L76/36. It is great in IHC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen