Vergleich

Anti-MFF Antibody

ArtNr 75-366
Hersteller Antibodies Incorporated
Menge 100 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC, ICC
Clon N382/14
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG1
Konjugat/Tag Unconjugated
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Mitochondrial fission factor
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Primary Antibody
Manufacturer - Targets
MFF
Country of Origin
United States
Shipping Temperature
Shipped on ice packs
Storage Conditions
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight
40 kDa
Manufacturer - Research Area
Mitochondrial Biology
Expiration
24 months from date of receipt
Immunogen
Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Immunogen Species
Human
Description
Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Target Description
Mitochondrial fission factor, also known as Mff, is a tail-anchored, outer mitochondrial membrane protein that is part of a complex process controlling mitochondrial and peroxisomal fission in conjunction with Drp1 and Fis1 (Schrader and Yoon, 2007). The rate of mitochondrial fission and fusion balance each other for cell growth and survival of mitochondria. Fission can be greatly accelerated when cytochrome c is released during apoptosis (Desagher and Martinou, 2000). Mff was identified as an important component of the process through siRNA transfected cells, isolating the protein in the P2 pellet and demonstrating that Mff is exposed to the cytosol (Gandre-Babbe and van der Bliek 2008). Mff has been identified at different stages of the fission process working alongside, rather than in complex with, Fis1 suggesting that Mff contributes to fission independent of the Fis1 complex (Gandre-Babbe and van der Bliek 2008).
Clonality
Monoclonal
Manufacturer - Specificity
No cross-reactivity reported
Concentration
1 mg/mL
Form
Purified by Protein A chromatography
Buffer
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application
WB Brain
Usage Statement
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement
We produce our MFF mouse monoclonal primary antibody from hybridoma clone N382/14. It is great in IHC, ICC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen