« Zurück
Startseite /
Anti-SUR1 and SUR2B Antibody

Anti-SUR1 and SUR2B Antibody

ArtNr	75-298
Hersteller	Antibodies Incorporated
Menge	100 uL
Kategorie	Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IHC, ICC
Clon	N323A/31
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
Konjugat/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	SUR1 and SUR2B
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	175 kDa (and smaller fragments likely due to proteolytic cleavage)
Manufacturer - Research Area	Ion Channels and Modulators, Ion Channel Modulators
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Immunogen Species	Rat
Description	Our Anti-SUR1 and SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323A/31. It detects mouse and rat SUR1 and SUR2B, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Target Description	SUR1 and SUR2B are members of the ATP binding cassette transporter subfamily C. These proteins combine with KCNJ8(Kir6.1) or KCNJ11(Kir6.2) to form K+ATP channels and are involved in their regulation and activation.
Clonality	Monoclonal
Manufacturer - Specificity	Cross-reacts with SUR1
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application	ICC
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our SUR1 and SUR2B mouse monoclonal primary antibody from hybridoma clone N323A/31. It is great in IHC, ICC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern