Anti-SVOP Antibody

ArtNr	75-353
Hersteller	Antibodies Incorporated
Menge	100 uL
Kategorie	Neuroscience Neural Signaling Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ICC
Clon	N356/23
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
Konjugat/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Synaptic vesicle 2-related protein (SV2-related protein)
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	SVOP
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	60 kDa
Manufacturer - Research Area	Transporter Proteins
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
Immunogen Species	Rat
Description	Our Anti-SVOP mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by Protein A chromatography. It is great for use in ICC, WB.
Target Description	Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.
Clonality	Monoclonal
Manufacturer - Specificity	Does not cross-react with SVOPL/SVOP2
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application	WB Brain
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our SVOP mouse monoclonal primary antibody from hybridoma clone N356/23. It is great in ICC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern