Vergleich

Anti-SUR1 Antibody

ArtNr 75-267
Hersteller Antibodies Incorporated
Menge 100 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC, ICC
Clon N289/16
Specific against Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Hamster
Host Mouse
Isotype IgG1
Konjugat/Tag Unconjugated
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Primary Antibody
Manufacturer - Targets
SUR1
Country of Origin
United States
Shipping Temperature
Shipped on ice packs
Storage Conditions
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight
180 kDa
Manufacturer - Research Area
Ion Channels and Modulators, Ion Channel Modulators
Expiration
24 months from date of receipt
Immunogen
Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
Immunogen Species
Rat
Description
Our Anti-SUR1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N289/16. It is KO validated, detects hamster, mouse, rat SUR1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Target Description
Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.
Clonality
Monoclonal
Manufacturer - Specificity
Does not cross-react with SUR2B (based on KO validation results)
Concentration
1 mg/mL
Form
Purified by Protein A chromatography
Buffer
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application
WB Brain
Usage Statement
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement
We produce our SUR1 mouse monoclonal primary antibody from hybridoma clone N289/16. It is great in IHC, ICC, WB and is purified by Protein A chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen