MKI67 Antibody

ArtNr	OAAN03278-100UL
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Cell Biology Cell Status Immunohistochemistry Western Blot ELISA Immunofluorescence Proliferation Viability Primary Antibodies By Organ Lung Cancer Bladder Cancer Breast Cancer Testicular & Prostate Cancer Adhesion Molecule Markers Cytoskeleton Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Sequence	GDGKSIRTFKESPKQILDPAARVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTPTSTKQWPKRSLRKADVEEEF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KIA,MIB-,MIB-1,PPP1R105
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	359 kDa
Manufacturer - Application Additional Information	WB: 1:500~1000
Gene symbol	MKI67
Gene Fullname	marker of proliferation Ki-67
Product format	Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Reconstitution and storage	Store at -20°C. Avoid freeze/thaw cycles.
Description of target	Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
Nucleotide accession_num	NM_001145966.1
Protein accession_num	NP_001139438.1
Protein name	Tyrosine-protein kinase Lyn
Clonality	Polyclonal
Purification	Affinity purification
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Ki67 (NP_001139438.1).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAN03278-100UL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern