« Zurück
Startseite /
PAX2 Antibody - middle region

PAX2 Antibody - middle region

ArtNr	P100859_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Metabolism Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Myeloma Sarcoma Mesothelioma Immunohistochemistry Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer Renal Cancer Calcium Binding Protein Markers Other Lipid\Cholesterol Metabolism Modulators
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS
Citations	Muratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997.
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FSGS7,PAPRS
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Neurobiology, Root Catalog/Products/Monoclonal Antibodies/Drugs and Drug Metabolism, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Chromatin Immunoprecipitation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	45kDa
Species Tested	Human
Gene symbol	PAX2
Gene Fullname	Paired box 2
Protein size	417
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2;
Description of target	PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.
Nucleotide accession_num	NM_003988
Protein accession_num	NP_003979
Protein name	Paired box protein Pax-2
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PAX2
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 7 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern