CD39L2 (CD39 Antigen-like 2, CD39-like-2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, Ectonucleoside Triphosphate Diphosphohydrolase 6, ENTPD6, FLJ36711, IL-6SAG, Interleukin 6 Signal Transducer 2, IL6ST2, NTPDase-6) (APC

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

Partial recombinant corresponding to aa386-484 from human ENTPD6 (NP_001238) with GST tag. MW of the GST tag alone is 26kD.

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.