Vergleich

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (APC)

ArtNr USB-124797-APC
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen ELISA
Clon 1G5
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Konjugat/Tag APC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Protein Kinases
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
EU Commodity Code
30021010
Immunogen
Full length recombinant corresponding to aa1-346 from human CDK7 (AAH00834.1) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human CDK7.
Description
CDK7, a CDC2/CDK type protein kinase, is the catalytic component of the Cdk-activating kinase (CAK) which acts as a regulator of cell cycle progression. CDK7 complexes with cyclin H and MAT1 to form CAK, and this multi-subunit protein phosphorylates the cyclin-dependent protein kinases CDC2/CDK1, CDK2, CDK4 and CDK6. CAK also associates with the transcription factor IIH (TFIIH) which functions in transcription initiation and DNA repair. TFIIH has been shown to be regulated by CDK8/cyclin C.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen