CORIN (Atrial Natriuretic Peptide-converting Enzyme,Pro-ANP-converting Enzyme,Corin,Heart-specific Serine Proteinase ATC2,Transmembrane Protease,Serine 10,Atrial Natriuretic Peptide-converting Enzyme,N-terminal Propeptid

Antibodies / Antibodies-Enzymes, Protease (Proteinase, Peptidase)

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Partial recombinant protein corresponding to aa616-715 from human CORIN with GST tag. MW of the GST tag alone is 26kD.

CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. This protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Applications:
Suitable for use in FLISA and Western Blot. Other applications have not been tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

AA Sequence:
CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.