CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) (PE)

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Partial recombinant protein corresponding to aa1-55 from human CXCR5 with GST tag. MW of the GST tag alone is 26kD.

Chemokines play an important role in inflammation and critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors. The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. CXCR5 is one of the CXCR receptors, which is expressed in a variety of cells.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP*

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.