HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II,AB-binding Alcohol Dehydrogenase,ABAD,CAMR,DUPXp11.22,ERAB,HCD2,HSD17B10,MHBD,Mitochondrial Ribonuclease P Protein 2,MRPP2,MRX17,MRX31,MRXS10,SCHAD,SDR5C1,Type II HADH,

Antibodies / Antibodies-Enzymes, Dehydrogenase

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Full length human HSD17B10, aa1-261 (NP_004484.1).

HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.