Vergleich

LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (FITC)

ArtNr USB-129227-FITC
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB
Clon 3B2
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Konjugat/Tag FITC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Leucine-rich Proteins
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
EU Commodity Code
30021010
Immunogen
Partial recombinant protein corresponding to aa2161-2260 from human LRRK2 with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human LRRK2.
Description
Parkinson is the second most common neurodegenerative disease after Alzheimers. About 1 percent of people over the age of 65 and 3 percent of people over the age of 75 are affected by the disease. The mutation is the most common cause of Parkinson's disease identified to date. LRRK2, a genetic mutation, was recently found linked to about 5 percent of inherited cases of Parkinson's disease. By high-resolution recombination mapping and candidate gene sequencing in 46 families, 6 disease-segregating mutations (5 missense and 1 putative splice site mutation). It may be central to the pathogenesis of several major neurodegenerative disorders associated with parkinsonism. LRRK2 belongs to the ROCO protein family and includes a protein kinase domain of the MAPKKK class and several other major functional domains.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen