Vergleich

MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B,Autophagy-related Protein LC3 B,Autophagy-related Ubiquitin-like Modifier LC3 B,MAP1 Light Chain 3-like Protein 2,MAP1A/MAP1B Light Chain 3 B,MAP1A/MAP1B LC3

ArtNr USB-129361-PE
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen ELISA
Clon 4E11
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2b
Konjugat/Tag PE
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Neuroscience
Manufacturer - Isotype
IgG2b, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
EU Commodity Code
30021010
Immunogen
Partial recombinant protein corresponding to aa1-71 from human MAP1LC3B with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human MAP1LC3B.
Description
Microtubule-associated protein 1 light chain 3 (LC3) is a fibronectin mRNA-binding protein linked to mRNA translation. Three human isoforms of MAP1-LC3 have been cloned and characterized (MAP1- LC3A, -B, -C). These isoforms differ in their post-translation modification. MAP-LC3 proteins are related to cell growth, differentiation and migration in development and in diseases.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associate

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen