Vergleich

MFN2 (Mitofusin 2, Mitofusin-2, CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF, Transmembrane GTPase MFN2) (FITC)

ArtNr USB-129610-FITC
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC
Clon 4H8
Specific against Human (Homo sapiens), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG2a
Konjugat/Tag FITC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-GTPase, Rab, Ras, Rho Proteins
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa661-757 from MFN2 (NP_055689) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human MFN2. Species Crossreactivity: rat.
Description
Mitofusin-2 (Mfn2) is a membrane protein of the mitochondria and is important in mitochondrial fusion in mammalian cells. Mfn2 activity has also been implicated in mitochondrial metabolism and the loss of Mfn2 may be the reason for certain metabolic modifications that are seen in individuals with obesity. Mfn2 has been associated with maintaining the membrane potential of the mitochondria. Mfn2 has been shown to hinder mitochondrial antiviral signaling by inhibiting production of type 1 interferons. Mfn2 is a p53-inducible target and involved in cell proliferation, apoptosis promotion and tumor suppression.

Applications:
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen