Vergleich

MSX1 (Homeobox Protein MSX-1, Homeobox Protein Hox-7, Msh Homeobox 1-like Protein, HOX7) (Biotin)

ArtNr USB-129943-Biotin
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IP, ELISA
Clon 1D2
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Konjugat/Tag Biotin
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Transcription Factors, Homeobox (HOX)
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
EU Commodity Code
30021010
Immunogen
Full length recombinant corresponding to aa216-297 from human MSX1 (NP_002439) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human MSX1.
Description
HOX7 is a 297aa novel member of homeodomain family of DNA binding domain family (meta HOX) that functions as a DNA-associated transcription factor. It has a helix-turn-helix and DNA binding domain. It plays an important role in inhibiting MYOD1 expression and is involved in epithelial-mesenchymal signaling in many organs, playing a role in limb-pattern formation. It acts as a potential repressor in cell cycle progression and as a RNA polymerase 2 transcription factor, involved in skeletal development. Northern blot analysis detects highest expression of HOX7 in heart along with other tissues like prostate and highly in dental mesenchyme during critical bud stage, placenta, etc.

Applications:
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen