NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (APC)

Antibodies / Antibodies-Receptors

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

Full length human NR2F2, aa1-414 (NP_066285.1).

COUP-TFII, a NR2 Hepatocyte NF4-Like receptor, has been shown to affect neuronal development and differentiation, homeostasis in various Human tissues, mesenchymal-epithelial interactions during organogenesis, and the development of the cardiovascular system. COUP-TFII interacts with and modulates several nuclear receptors, including estrogen receptor alpha (ER alpha), thyroid hormone receptors (TR), PPAR alpha, and retinoic acid receptors (RAR). Mice lacking COUP-TFII show abnormal heart and vascular development. COUP-TFII expression has been documented in Human adrenal, lung, kidney, liver, spleen, skeletal muscle, and breast. ESTs have been isolated from Human tissue libraries, including cancerous adrenal, bladder, brain, breast, colon, head/neck, kidney, lung, ovary, pancreas, pituitary, prostate, skeletal muscle, skin, smooth muscle, stomach, synovium, and uterus, and normal brain, adipose, adrenal, blood, brain, breast, cervix, ear, embryo, gallbladder, ganglion, heart, kidney, liver/spleen, lung, ovary, placenta, prostate, skin, spleen, testis, uterus, and vessel.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.