PRPF31 (Pre-mRNA-processing Factor 31, U4/U6 Small Nuclear Ribonucleoprotein Prp31, PRP31, hPrp31, RP11, Serologically Defined Breast Cancer Antigen NY-BR-99, U4/U6 snRNP 61kD Protein, Protein 61K) (PE)

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Partial recombinant corresponding to aa400-500 from human PRPF31 (NP_056444) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.