Vergleich

RON (p185-Ron, CDW136, CD136, MST1R, Macrophage-stimulating Protein Receptor alpha Chain, Macrophage-stimulating Protein Receptor beta Chain, Macrophage-stimulating Protein Receptor MSPR, MSP Receptor, Protein-tyrosine Kinase 8, PTK8) (HRP)

ArtNr USB-132724-HRP
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen ELISA
Clon 4E2
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Konjugat/Tag HRP
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Protein Kinases
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa26-125 from human MST1R (NP_002438) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human MST1R.
Description
Macrophage stimulating protein receptor, encoded by the human RON and the mouse Stk genes, is one of a family of receptor tyrosine kinases that also includes human Met. This family of receptors is synthesized as a single-chain precursor that is cleaved into a mature disulfide-linked heterodimer composed of an extracellular a chain and a membrane spanning b chain with intrinsic tyrosine kinase activity. Expression of MSP R is restricted to specific areas of the central and peripheral nervous systems, epithelial cells along the digestive tract, skin and lung, and in subpopulations of the mononuclear phagocyte lineage. Both the MSP heterodimer and the free MSP b chain have been shown to bind MSP R. However, only the MSP heterodimer can induce receptor dimerization and phosphorylation and cause biological activity.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
RON (p185-Ron, CDW136, CD136, MST1R, Macrophage-stimulating Protein Receptor alpha Chain, Macrophage-stimulating Protein Receptor beta Chain, Macrophage-stimulating Protein Receptor MSPR, MSP Receptor, Protein-tyrosine Kinase 8, PTK8) (HRP)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen