S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133) (HRP)

Antibodies / Antibodies-Binding Proteins, Calcium

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Full-length recombinant corresponding to aa1-98 from human S100A10 (AAH15973) with GST tag. MW of the GST tag alone is 26kD.

S100A10/p11 belongs to the S-100 calcium binding protein family, although it has had crucial aa substitutions and deletions that render it incapable of binding calcium. p11 forms a heterotetrameric complex with annexin II. p11 functions as an auxiliary protein and has been shown to interact directly the potassium channel TASK-1. It is essential for TASK1 trafficking to the plasma membrane. p11 also increases the localization of 5HT1B receptors to the cell surface.

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK*

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.