SCN2B (Sodium Channel Subunit beta-2, UNQ326/PRO386) (HRP)

Antibodies / Antibodies-Ion Channel

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).

Full length recombinant corresponding to aa1-215 from human SCN2B with GST tag. MW of the GST tag alone is 26kD.

Scn2b encodes one type of beta subunit found in voltage-gated sodium channels. These channels, composed of one alpha and one or two different beta subunits, mediate changes in cell permeability to sodium ions that are essential for the generation of action potentials. Scn2b protein, comprised of an extracellular N-terminus with an immunoglobulin-like fold and a single transmembrane domain, has been shown in brain tissues to be covalently linked through disulfide bonds to the alpha subunit. Scn2b is considered an auxiliary subunit that modulates cell-surface expression and gating, though its function in heart myocytes may be limited to cell adhesion. Scnb2 null mice display increased susceptibility to seizures. Expression of Scn2b has been shown to be suppressed with exposure to pneumococcal acute otitis media.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK*

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.