Vergleich

TROVE2 (RO60, SSA2, 60kD SS-A/Ro Ribonucleoprotein, Ro 60kD Autoantigen, Sjoegren Syndrome Antigen A2, Sjoegren Syndrome Type A Antigen, TROVE Domain Family Member 2) (PE)

ArtNr USB-134786-PE
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IF
Clon 1F2
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Konjugat/Tag PE
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Nuclear Proteins
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa1-101 from human TROVE2 (NP_004591) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human TROVE2.
Description
RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation.

Applications:
Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS*

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen