EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4, Eph Homology Kinase-1, Ephrin Receptor EphA5, Ephrin Type-A Receptor 5, Receptor Protein-Tyrosine Kinase HEK7, Tyrosine-Protein Kinase Receptor EHK-1)

Mab

IgG3, k

-20°C

Supplied as a liquid in PBS, pH 7.4.

Recombinant protein corresponding to aa234-333 from human EPHA5 with GST tag. MW of the GST tag alone is 26kD.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEP PKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRP GFFKASPHIQSCGKCPPHSYTHEEAS

Storage and Stability:
May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.