Vergleich

FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like

ArtNr USB-207650-APC
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB
Clon 3A8
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2b
Konjugat/Tag APC
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Protein Kinases
Manufacturer - Isotype
IgG2b, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
EU Commodity Code
30021010
Immunogen
Recombinant protein corresponding to aa1-90 from human FYN with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human FYN.
Description
This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP QHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHT GTLRTRGGTGVTLFVAL

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like Kina

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen