FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.4.

Recombinant protein corresponding to aa1-90 from human FYN with GST tag. MW of the GST tag alone is 26kD.

This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP QHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHT GTLRTRGGTGVTLFVAL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.