TCL1A (T-Cell Leukemia/lymphoma 1A, T-Cell Lymphoma-1, T-Cell Lymphoma-1A, TCL1)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.4.

Recombinant protein corresponding to aa61-114 from human TCL1A with GST tag. MW of the GST tag alone is 26kD.

Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.

Applications:
Suitable for use in Immunofluorescence and ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.