Vergleich

FOS (v-fos FBJ murine Osteosarcoma Viral Oncogene Homolog, AP-1, C-FOS) (MaxLight 550)

ArtNr USB-246245-ML550
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IF
Clon 2D12
Specific against other
Host Mouse
Isotype IgG2a
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Transcription Factors
Manufacturer - Isotype
IgG2a, k
Manufacturer - Conjugate / Tag
MaxLight 550
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
EU Commodity Code
30021010
Immunogen
FOS (NP_005243.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes FOS.
Description
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150, 000.

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. [provided by RefSeq

Applications:
Suitable for use in Immunofluorescence, FLISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen