Vergleich

FZD4 (Frizzled Homolog 4 (Drosophila), CD344, EVR1, FEVR, FZD4S, Fz-4, FzE4, GPCR, MGC34390)

ArtNr USB-246422
Hersteller United States Biological
Menge 200 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, ELISA
Clon 3G7
Specific against other
Host Mouse
Isotype IgG2b
Purity Ascites
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Wnt Proteins
Manufacturer - Isotype
IgG2b, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Ascites
Form
Supplied as a liquid.
EU Commodity Code
30021010
Immunogen
FZD4 (NP_036325, 107aa-206aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes FZD4.
Description
This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen