Vergleich

HOXC4 (Homeobox C4, HOX3, HOX3E, cp19)

ArtNr USB-247234
Hersteller United States Biological
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IF, ELISA
Clon 2D6
Specific against other
Host Mouse
Isotype IgG1
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Transcription Factors, Homeobox (HOX)
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.4.
EU Commodity Code
30021010
Immunogen
HOXC4 (NP_705897, 160aa-264aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human HOXC4.
Description
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. [provided by RefSeq

Applications:
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen