RRM2B (Ribonucleotide Reductase M2 B (TP53 Inducible), DKFZp686M05248, MGC102856, MGC42116, p53R2)

Mab

IgG2a, k

-20°C

Supplied as a liquid.

RRM2B (NP_056528, 3aa-84aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Mouse monoclonal antibody raised against a partial recombinant RRM2B.

Applications:
Suitable for use in ELISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.