Otx2, CT (CPHD6, Homeobox Protein OTX2, MCOPS 5, MCOPS5, Orthodenticle 2, Orthodenticle Homeobox 2, Orthodenticle Homolog 2 (Drosophila), Orthodenticle Homolog 2, Orthodenticle2, Otx 2, OTX2_HUMAN)

Antibodies / Antibodies-Transcription Factors, Homeobox (HOX)

-20°C

Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.

Synthetic peptide corresponding to aa258-289, DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL, from human Otx2 at C-terminal, identical to the related mouse sequence.

OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.1ng/lane under reducing conditions.
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.