SMAD1/2/3/4/5 (BSP 1, DwfA, HSMAD1, JV41, MAD Homolog 1, Mad-related Protein 1, Smad1, HMAD 2, JV18, MAD Homolog 2, SMAD 2, HMAD 3, JV15 2, MAD3, SMAD 3, HSMAD4, MADH 4, SMAD4, JV5 1, Dwfc, SMAD 5)

Antibodies / Antibodies-Smad Proteins

-20°C

Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.

Synthetic peptide corresponding to aa240-270, QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH, from the middle region of human SMAD1/2/3/4/5, different from the related mouse sequence by 2aa, and from the related rat sequence by 5aa.

SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.1ng/lane under reducing conditions.
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.