HNRNPA1, NT (Heterogeneous Nuclear Ribonucleoprotein A1)

Antibodies / Antibodies-Nuclear Proteins

-20°C

Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.

Synthetic peptide corresponding to a sequence at the N-terminal of human HnRNP A1 (aa8-42, KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Applications: 
Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry (paraffin): 0.5-1ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.