Vergleich

ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1,16A,Ac45,ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1,ATP6S1,ATPase H+ Transporting Lysosomal Interacting Protein 1,ATP6IP1,CF2,H-ATPase

ArtNr USB-A4000-80-ML650
Hersteller United States Biological
Menge 100 ul
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB
Clon 10B237
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Enzymes, Synthase
Manufacturer - Conjugate / Tag
MaxLight 650
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
EU Commodity Code
30021010
Immunogen
Partial recombinant protein corresponding to a portion of corresponding to a portion of amino acids within aa51-151 of human ATP6AP1 (NP_001174), with GST tag. MW of GST tag alone is 26kD.
Specificity
Recognizes human ATP6AP1.
Description
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250, 000.

This gene encodes a component of a multisubunit enzyme (1mD MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules. [provided by RefSeq]

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended DilutionS:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
ATPase H+ Transporting Lysosomal Accessory Protein 1 (ATP6AP1, 16A, Ac45, ATPase H+ Transporting Lysosomal (Vacuolar Proton Pump) Subunit 1, ATP6S1, ATPase H+ Transporting Lysosomal Interacting Protein 1, ATP6IP1, CF2, H-ATPase Subunit, MGC129781, Pr

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen