Vergleich

Anti-CAV1 Antibody Europäischer Partner

ArtNr ANTI-A12510-100
Hersteller Antibodies.com
Menge 100 ul
Kategorie
Typ Antibody Primary
Format Liquid
Applikationen ICC
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Sequence MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Lieferbar
Manufacturer - Targets
Caveolin 1
Storage Conditions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description
Rabbit polyclonal antibody to Caveolin 1.
Clonality
Polyclonal
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Caveolin-1 (NP_001744.2).
Manufacturer - Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Purification
Affinity purification.
Recommended dilutions
ICC/IF: 1:50-1:200

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen