Anti-SIN3A Antibody

ArtNr	ANTI-A13518-200
Hersteller	Antibodies.com
Menge	200 ul
Kategorie	Antibodies Immunoprecipitation Western Blot Immunofluorescence Primary Antibodies CHiP
Typ	Antibody Primary
Applikationen	WB, IF, IP, CHIP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Sequence	MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Manufacturer - Targets	SIN3A
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description	Rabbit polyclonal antibody to SIN3A.
Clonality	Polyclonal
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SIN3A (NP_056292.1).
Manufacturer - Formulation	Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification	Affinity purification.
Recommended dilutions	WB: 1:500-1:2000, IF: 1:50-1:200, IP: 1:50-1:100, ChIP:: 1:20-1:100
Molecular weight	165kDa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ul

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern