Vergleich

Anti-METTL13 Antibody Europäischer Partner

ArtNr ANTI-A15548-200
Hersteller Antibodies.com
Menge 200 ul
Kategorie
Typ Antibody Primary
Applikationen WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Lieferbar
Manufacturer - Targets
METTL13
Storage Conditions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description
Rabbit polyclonal antibody to METTL13.
Clonality
Polyclonal
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3).
Manufacturer - Formulation
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification
Affinity purification.
Recommended dilutions
WB: 1:500-1:2000, IHC: 1:50-1:100
Molecular weight
90kDa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen