« Zurück
Startseite /
Anti-METTL7B Antibody

Anti-METTL7B Antibody

ArtNr	ANTI-A15591-50
Hersteller	Antibodies.com
Menge	50 ul
Kategorie	Antibodies Western Blot Immunocytochemistry Primary Antibodies Immunochemistry
Typ	Antibody Primary
Format	Liquid
Applikationen	WB, ICC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	RPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Manufacturer - Targets	METTL7B
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description	Rabbit polyclonal antibody to METTL7B.
Clonality	Polyclonal
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human METTL7B (NP_689850.2).
Manufacturer - Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Purification	Affinity purification.
Recommended dilutions	WB: 1:500-1:1, 000, ICC/IF: 1:50-1:200
Molecular weight	28 kDa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ul

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern