« Zurück
Startseite /
Anti-SARS-CoV Nucleoprotein Antibody [3861]

Anti-SARS-CoV Nucleoprotein Antibody [3861]

ArtNr	ANTI-A278811-100
Hersteller	Antibodies.com
Menge	100ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Liquid
Applikationen	WB, ELISA
Clon	3861
Specific against	Viral
Host	Mouse
Isotype	IgG1
Konjugat/Tag	Unconjugated
Sequence	MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Specificity	This antibody recognises nucleoprotein, also known as nucleocapsid protein and Protein N. The nucleoprotein (N) is the most abundant viral protein in SARS-CoV-infected cells. It is one of the four structural proteins essential for viral assembly, alongsid
Product Description	Mouse monoclonal [3861] antibody to SARS-CoV Nucleoprotein.
Clonality	Monoclonal
Reactivity	Viral
Immunogen	Recombinant fragment amino acids 1-49 of the SARS nucleoprotein.
Concentration	1 mg/ml
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.
Protein Length	49
Amino acids	aa 1 - 49
Purification	Protein A affinity chromatography.
Storage	Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Recommended dilutions	ELISA: 10 µg/ml - 1 µg/ml, WB: 1 µg/ml
Target	SARS-CoV Nucleoprotein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 21.08.2025