« Zurück
Startseite /
Anti-CD120b Antibody [22221 (2/220)]

Anti-CD120b Antibody [22221 (2/220)]

ArtNr	ANTI-A279134-100
Hersteller	Antibodies.com
Menge	100 ug
Kategorie	Antibodies Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining Functional Assays
Typ	Antibody Primary
Format	Liquid
Applikationen	WB, IHC, ELISA, FA
Clon	22221 (2/220)
Specific against	Human (Homo sapiens)
Host	Mouse
Isotype	IgG2a
Konjugat/Tag	Unconjugated
Sequence	LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Storage Conditions	Store undiluted at -20°C only. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.
Product Description	Mouse monoclonal [22221 (2/220)] antibody to TNF Receptor II.
Clonality	Monoclonal
Immunogen	E. coli derived recombinant peptide corresponding to amino acids 23 to 257 of human CD120b.
Concentration	1 mg/ml
Manufacturer - Formulation	Supplied in Phosphate Buffered Saline with 5% Trehalose.
Purification	Protein G affinity chromatography of ascites.
Recommended dilutions	ELISA: 0.5 - 1.0 µg/m, IHC-Fr: 15 - 25 µg/ml, WB: 1.0 - 2.0 µg/ml, Using the concentrations stated the detection limit is 5 ng/well
Protein Length	235
Manufacturer - Specificity	This antibody recognises recombinant and native human soluble TNF RII. This antibody neutralizes the biological effect of rhTNF RII, but not rhTNF RI.
Endotoxin level	< 0.1 EU/µg
Amino acids	aa 23 - 257

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 15.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern