« Zurück
Startseite /
Anti-TIM-3 Antibody [RMT3-23]

Anti-TIM-3 Antibody [RMT3-23]

ArtNr	ANTI-A281689-100
Hersteller	Antibodies.com
Menge	100T
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	FC
Clon	RMT3-23
Specific against	Mouse (Murine, Mus musculus)
Host	Rat
Isotype	IgG2a
Konjugat/Tag	PE
Sequence	MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Specificity	This antibody recognises mouse T-cell immunoglobulin mucin 3, a transmembrane glycoprotein and member of the immunoglobulin superfamily, preferentially expressed by differentiated CD4+ Th1 cells and CD8+ Tc1 (cytotoxic) cells, but not by CD4+ Th2 cells or
Product Description	Rat monoclonal [RMT3-23] antibody to TIM 3 (PE).
Clonality	Monoclonal
Immunogen	Tim-3-Ig, consisting of amino acids 1-191 of mouse Tim-3, coupled with the Fc portion of mouse IgG2a.
Concentration	Reconstitution dependent.
Product form	Lyophilized
Formulation	Supplied in Phosphate Buffered Saline with 1% BSA, 5% Sucrose, and 0.09% Sodium Azide.
Protein Length	191
Amino acids	aa 1 - 191
Purification	Protein G affinity chromatography of tissue culture supernatant.
Storage	Lyophilized: Store at 4°C. Reconstituted: Store undiluted at 4°C. Do not freeze! This product is photosensitive and should be protected from light. Should this product contain a precipitate we recommend microcentrifugation before use.
Recommended dilutions	Flow Cytometry: Neat, Use 10µl of the suggested working dilution to label 10⁶ cells in 100µl.
Target	TIM 3
Reconstitution	Reconstitute with 1 ml of distilled water.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100T

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern