« Zurück
Startseite /
FOXA3 Antibody - middle region

FOXA3 Antibody - middle region

ArtNr	ARP31945_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers Glial Cell Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
Citations	Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). 22959654 Kaestner,K.H. et al., (2000) Trends Endocrinol. Metab. 11 (7), 281-285
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FKHH3,HNF3G,TCF3G
Similar products	FOXA3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Epigenetics, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	37kDa
Species Tested	Human, Mouse
Gene symbol	FOXA3
Gene Fullname	Forkhead box A3
Protein size	350
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PPARA; ALX4; TLE2; TLE1; HMGB1;
Description of target	FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Nucleotide accession_num	NM_004497
Protein accession_num	NP_004488
Protein name	Hepatocyte nuclear factor 3-gamma
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human FOXA3
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Zebrafish: 79%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern