Vergleich

PSMD4 Antibody - N-terminal region

ArtNr ARP58060_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host Rabbit
Sequence VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL
Citations Ghi, P., Di Brisco, F., Dallorto, D., Osella, M. C. & Orsetti, M. Age-related modifications of egr1 expression and ubiquitin-proteasome components in pet dog hippocampus. Mech. Ageing Dev. 130, 320-7 (2009). 19428450
Elangovan,M., (2007) Biochem. Biophys. Res. Commun. 364 (2), 226-230
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AF,ASF,S5A,AF-1,MCB1,Rpn10,pUB-R5
Similar products PSMD4
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/DNA Repair, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
41 kDa
Species Tested
Human
Gene symbol
PSMD4
Gene Fullname
Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Protein size
377
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; cdc20; XPC; SPRTN; PSMD14; MDM2; PSMC2; PSMA1; ADRM1; UBQLN1; TXNL1; PSMD3; PSMD2; PSMD1; PSMC6; PSMC4; PSMC1; UCHL5; RPS12; PSMD8; UBQLN4; VCP; GJA1; DIO2; SCHIP1; FBXO6; PARK2; UL76; FBXO25; LOC100044627; Gm4705; LOC677113; Rps6-ps4; Rpl34-ps1; Rpl
Description of target
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Subunit
4
Nucleotide accession_num
NM_002810
Protein accession_num
NP_002801
Protein name
26S proteasome non-ATPase regulatory subunit 4
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 100%
Concentration
0.5 mg/ml
Sample Type Confirmation

PSMD4 is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen