Vergleich

ROM1 Antibody - middle region

ArtNr ARP44260_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host Rabbit
Sequence NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT
Citations Taylor,T.D., (2006) Nature 440 (7083), 497-500
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ROM,RP7,ROSP1,TSPAN23
Similar products ROM1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
37kDa
Species Tested
Human
Gene symbol
ROM1
Gene Fullname
Retinal outer segment membrane protein 1
Protein size
351
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
PHGDH; PRPH2;
Description of target
ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Nucleotide accession_num
NM_000327
Protein accession_num
NP_000318
Protein name
Rod outer segment membrane protein 1
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ROM1
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen