« Zurück
Startseite /
TTRAP Antibody - middle region

TTRAP Antibody - middle region

ArtNr	ARP33010_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Hematology Lymphoma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Immunohistochemistry Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers Stem Cell Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
Citations	Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. (2016). 27789688 Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. 45, 1159-1176 (2017). 28180300 Xu, G.-L. et al. TTRAP is a novel PML nuclear bodies-associated protein. Biochem. Biophys. Res. Commun. 375, 395-8 (2008). 18706885 Pei,H., et al., (2003) Oncogene 22 (18), 2699-2709
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EAP2,AD022,EAPII,TTRAP,hTDP2,dJ30M3.3
Similar products	TTRAP
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Receptors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	41kDa
Species Tested	Human
Gene symbol	TDP2
Gene Fullname	Tyrosyl-DNA phosphodiesterase 2
Protein size	362
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; SRPK2; SUMO1; SUMO2; SUMO3; TAP1; SKIL; ATXN1; PSEN1; SMAD3; EPS8; DLX3; ATP5G2; C2orf88; JAM2; SNX13; AKAP9; RAB11A; PARK7; MAPK6; UBE2I; TRAF5; TRAF6; TRAF3; TRAF2; FLI1; TNFRSF1B; ETS2; ETS1; TNFRSF8; CD40; HTNVsSgp1;
Description of target	The TTRAP gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.
Nucleotide accession_num	NM_016614
Protein accession_num	NP_057698
Protein name	Tyrosyl-DNA phosphodiesterase 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	TDP2 is supported by BioGPS gene expression data to be expressed in HepG2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern