« Zurück
Startseite /
BRCA1 Antibody - N-terminal region

BRCA1 Antibody - N-terminal region

ArtNr	ARP30434_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Neural Transcription Factors Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Neural Epigenetics Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Western Blot Enzymes Fatty Acid Synthesis Primary Antibodies By Organ Breast Cancer Heart & Blood Cancer Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	IRIS,PSCP,BRCAI,BRCC1,FANCS,PNCA4,RNF53,BROVCA1,PPP1R53
Similar products	BRCA1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Epigenetics, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/DNA Repair, Root Catalog/Research Areas/Methylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Cell Cycle, Root Catalog/Research Areas/Cancer/Cancer DNA Damage, Root Catalog/Research Areas/Cancer/Cancer Signal Transduction
Shipping Temperature	Wet Ice
Molecular Weight	76kDa
Species Tested	Human
Gene symbol	BRCA1
Gene Fullname	Breast cancer 1, early onset
Protein size	680
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H
Description of target	The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.
Nucleotide accession_num	NM_007298
Protein accession_num	NP_009229
Protein name	Breast cancer type 1 susceptibility protein
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human BRCA1
Homology	Dog: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 77%
Concentration	0.5 mg/ml
Sample Type Confirmation	BRCA1 is supported by BioGPS gene expression data to be expressed in ACHN

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern