Vergleich

RPS2 Antibody - middle region

ArtNr ARP63572_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae)
Host Rabbit
Sequence GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVA
Citations Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis. Plant Cell. 25, 1523-40 (2013). 23667124
Deletion of the N-Terminal Domain of Yeast Eukaryotic Initiation Factor 4B Reprograms Translation and Reduces Growth in Urea. Front Mol Biosci. 8, 787781 (2022). 35047555
Zfrp8/PDCD2 Interacts with RpS2 Connecting Ribosome Maturation and Gene-Specific Translation. PLoS ONE. 11, e0147631 (2016). 26807849
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias S2,LLREP3
Similar products RPS2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
32kDa
Species Tested
Human
Gene symbol
RPS2
Gene Fullname
Ribosomal protein S2
Protein size
293
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; TP53; CEP250; TUBGCP3; TUBG1; NEDD1; STAU1; MDM2; RNF2; rev; RPS29; RPS28; RPS26; RPS25; RPS24; RPS23; RPS21; RPS20; RPS19; RPS18; RPS16; RPS15A; DYNLL1; EIF3CL; WIBG; TSR1; SND1; RPS15; RPS14; RPS13; RPS12; RPS11; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5
Description of target
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Nucleotide accession_num
NM_002952
Protein accession_num
NP_002943
Protein name
40S ribosomal protein S2
Clonality
Polyclonal
Purification
Affinity Purified
Homology
Dog: 100%; Pig: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Concentration
0.5 mg/ml
Sample Type Confirmation

RPS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen