Vergleich

TCF3 Antibody - N-terminal region

ArtNr ARP38267_T100
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL
Citations Maruyama,K. (2005) J. Biol. Chem. 280 (41), 34577-34589
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias E2A,E47,p75,AGM8,ITF1,VDIR,TCF-3,bHLHb21
Similar products TCF3
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Neuroscience, Root Catalog/Research Areas/Acetylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature
Wet Ice
Molecular Weight
68kDa
Species Tested
Human
Gene symbol
TCF3
Gene Fullname
Transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Protein size
654
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
ID3; FAM115A; TLE1; RNF14; UBC; SCX; MAPKAPK2; MAPKAPK3; TCF21; Ube2i; ID2; FUS; CTNNB1; RPL37; MAX; USF1; TCF12; TCF3; MYOD1; Rufy1; Tfap4; Rpa1; Tbx6; Ncl; Twist2; SUPT3H; TRRAP; KAT2A; TADA2A; FOXH1; ELAVL1; TCF24; SETSIP; FLG2; BHLHA15; MYL6B; TIMM50;
Description of target
TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.
Nucleotide accession_num
NM_003200
Protein accession_num
NP_003191
Protein name
Transcription factor E2-alpha
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 77%; Rat: 100%
Concentration
1.0 mg/ml
Sample Type Confirmation

TCF3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen