« Zurück
Startseite /
RHPN1 Antibody - middle region

RHPN1 Antibody - middle region

ArtNr	ARP52451_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies By Organ Lymphatic System Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
Citations	Jaffe,A.B., (2004) Mol. Cell. Biol. 24 (4), 1736-1746
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ODF5,RHPN,RHOPHILIN
Similar products	RHPN1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	73kDa
Species Tested	Human
Gene symbol	RHPN1
Gene Fullname	Rhophilin, Rho GTPase binding protein 1
Protein size	670
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	MTUS2; TRIM27; ROPN1B; CNKSR1; CALCOCO2; TRIM37; EFEMP2; RHOA; KRT15;
Description of target	RHPN1Â¡Â¡has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
Nucleotide accession_num	NM_052924
Protein accession_num	NP_443156
Protein name	Rhophilin-1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RHPN1
Homology	Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 86%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 10 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern